PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 157aa    MW: 18079 Da    PI: 10.0881
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.12.6e-141048240
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                    +i+++s r+ t+ kR++gi+KK +EL +LC++ ++ ii 
  XP_004496032.1 10 FISDDSARKATYKKRKKGIIKKVSELTILCGIPACAIIS 48
                    89*********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-19160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-22182IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.544147IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MTRKKVKLAF ISDDSARKAT YKKRKKGIIK KVSELTILCG IPACAIISNP FDSQTEVWPD  60
PEGAKHVIER YQKSSVIDET KNVNQESFLL QRIVKARDQL KKQRLENHEK DLTILMFGYM  120
QTKNLPDHLT VAELKDFDKL IHKNLKEIDN QIATTLA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFISDDSARKATYKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496032.11e-113PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLG7JY851e-79G7JY85_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA10G28320.11e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13237929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.11e-33M-type_MADS family protein